Description | Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MESMQLDQIDVKPQLLTGSNENSSSESESQKVTELEILPVIYEIIRSIEKDPVDNATKQKESQDCSQKVLELQKRLESARITIRQLPGIEYSKEEQLRRLESLRKQLALKQQLIKKYKNVQF |
Length | 122 |
Position | Middle |
Organism | Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Culicinae> Aedini> Aedes> Stegomyia. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.802 |
Instability index | 74.64 |
Isoelectric point | 6.38 |
Molecular weight | 14218.09 |
Publications | PubMed=26483478 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07815 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 67.09| 25| 35| 29| 63| 1 --------------------------------------------------------------------------- 3- 36 (30.39/24.48) SMQLDQIDvkpqlltGSNENSSSEseSQKVTELE 47- 73 (36.70/12.26) SIEKDPVD.......NATKQKESQdcSQKVLELQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KKYKN 2) MESMQLDQIDVKPQLLTGSNENSSSESESQKVTELEILPVIYEIIRSIEKDPVDNATKQKESQDCSQKVLELQKRLESARITIRQLPGIEYSKEEQLRRLESL | 115 1 | 119 103 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab