<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07809

Description Mediator of RNA polymerase II transcription subunit 28
SequenceMNWKKSQVERCPATVYYVPNFITPEEEASILQAVSRAPKPKWTHLANRRLINYGGIPHPKGMIAESIPAWLERYVDRINELGLFEQGTKANHVLVNEYLPGQGIMPHLDGPLFYPTITTISCGSHTLLEYFEQSENETQCTLTMASSSNGSGNLVDELEEAFQSCIHALTKEESATGIDKDEIKVEVDQTTLKFIDLARQMEAFFLQKRFLLSALKPDLLLKEENFDLKQEIARKDELIRKHYEKIETWKQLLSDQQNFNKPIQSLPPDMRGNLAGGAPGGAPGAIMPGGGMGLPMQNMSQVQQMQNQHQQQQQMQQLQAQQQQMQQQMQQSLPMGAGNAQLFQQGGVPRGVGQGGGPGPGFPPGAGPNLQGPLAYLEKTASNIDLVGMGDGRR
Length394
PositionHead
OrganismAnopheles albimanus (New world malaria mosquito)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Anophelinae> Anopheles.
Aromaticity0.07
Grand average of hydropathy-0.540
Instability index49.43
Isoelectric point5.58
Molecular weight43637.08
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP07809
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.82|      15|      17|     297|     313|       1
---------------------------------------------------------------------------
  297-  311 (30.02/16.68)	QNM.SQVQQMQNQHQQ
  316-  331 (24.80/ 7.37)	QQLqAQQQQMQQQMQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      90.20|      26|      65|     265|     293|       3
---------------------------------------------------------------------------
  265-  291 (50.22/26.41)	SLPPDmRGNL....AGGAP.....GGAPG.AIMPGGG
  332-  367 (39.98/12.57)	SLPMG.AGNAqlfqQGGVPrgvgqGGGPGpGFPPGAG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.42|      21|      46|      41|      61|       4
---------------------------------------------------------------------------
   41-   61 (42.21/25.81)	KWTH.LANRRLINYGGIPHPKG
   89-  110 (36.22/21.16)	KANHvLVNEYLPGQGIMPHLDG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.23|      22|      24|     117|     140|       5
---------------------------------------------------------------------------
  117-  140 (35.60/32.98)	ITTISCGSHTLLEYFEqsENETQC
  144-  165 (37.63/27.31)	MASSSNGSGNLVDELE..EAFQSC
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP07809 with Med28 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) QNFNKPIQSLPPDMRGNLAGGAPGGAPGAIMPGGGMGLPMQNMSQVQQMQNQHQQQQQMQQLQAQQQQMQQQMQQSLPMGAGNAQLFQQGGVPRGVGQGGGPGPGFPPGAGPNLQGPLAYLEKTASNIDLVGMGDGRR
257
394










Molecular Recognition Features






MoRF SequenceStartStop




NANANA