<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07807

Description Mediator of RNA polymerase II transcription subunit 29
SequenceMFPQQTMMNSNLMMQQQAQQQAQQQAQQQAQQQAQQQAQQQAQQQAQQQAQQQAQQQQAQQHQISQQPNQAQQTEKVDNISKVKGLVGPLRDALSTTIKTAAQLIQQNNLTDAGSKTVDHNNAAPRFDKHLEEFYSICDQIELNLKTAKLCLQQCSSSQTYLPIPVATSQQPPPETNALTYNQYLEVVKLQIGYAKDIHDTLICAAQNISPSE
Length213
PositionTail
OrganismAnopheles albimanus (New world malaria mosquito)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Anophelinae> Anopheles.
Aromaticity0.04
Grand average of hydropathy-0.861
Instability index64.13
Isoelectric point5.76
Molecular weight23869.25
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP07807
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.91|      14|      14|      15|      28|       1
---------------------------------------------------------------------------
   26-   41 (26.96/ 6.15)	AQQqaQQQAQQQAQQQ
   42-   57 (26.96/ 6.15)	AQQqaQQQAQQQAQQQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP07807 with Med29 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MFPQQTMMNSNLMMQQQAQQQAQQQAQQQAQQQAQQQAQQQAQQQAQQQAQQQAQQQQAQQHQISQQPNQAQQTEKVDNISKVKGL
1
86










Molecular Recognition Features






MoRF SequenceStartStop




NANANA