<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07788
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MPISSPPNSQKMKFSRNIMYFTQELTYVKLLWNGCKHHSLHTTPTPTPTHKLVQISIRAMANKMVGKGKLAVESEDAQKLRFQVELEFVQCLANPNYLHFLAQRGYFKDAAFVNYLKYLLYWKEPEYAKYIKFPMCLYFLDLLQYEHFRREIVSAQCCKFIDDQAILLWQHYTRRRTRLTALGTTSLTGLAVGGQPVGGGVQGTLLSNEPSIMASCNNGNNGSQNSSSNNGTMSGGGGLLNSNSMNSNNGPNGGAVVGVNMAPSSAQQSIAQNGGASMTQHNGVGGLLMGNPLGSLGSGAVGGGGGSVTGSGGGGGGGGSINQKVP |
| Length | 326 |
| Position | Middle |
| Organism | Anopheles albimanus (New world malaria mosquito) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.268 |
| Instability index | 42.29 |
| Isoelectric point | 9.41 |
| Molecular weight | 34721.06 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07788
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 72.69| 14| 15| 225| 238| 1
---------------------------------------------------------------------------
225- 238 (27.15/10.06) NSSSNNGTMSGGGG
293- 306 (22.93/ 7.39) LGSLGSGAVGGGGG
308- 319 (22.61/ 7.19) VTGSGGG..GGGGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.42| 15| 30| 206| 222| 3
---------------------------------------------------------------------------
206- 222 (21.16/24.14) LSNEPSiMAScNNGNNG
239- 253 (30.26/19.94) LLNSNS.MNS.NNGPNG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.52| 17| 24| 128| 150| 4
---------------------------------------------------------------------------
136- 156 (26.48/32.45) CLYFLD...LLQYEHF..RReivsAQ
157- 178 (24.04/10.47) CCKFIDdqaILLWQHYtrRR....TR
---------------------------------------------------------------------------
|