<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07782
Description |
Uncharacterized protein |
Sequence | XPLDYSDHVAKLARKVDWRKLIGAEATYDNPDALPRDDGEEIEEKEPEEVVIGMEDRKTPEAGPWHTVAKYLQ |
Length | 73 |
Position | Head |
Organism | Onchocerca ochengi (Filarial nematode worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Onchocerca.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.967 |
Instability index | 43.34 |
Isoelectric point | 4.59 |
Molecular weight | 8233.02 |
Publications | PubMed=22919073
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP07782
No repeats found
No repeats found
|