<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07781
Description |
Uncharacterized protein |
Sequence | XSTAQPAGVNIAIEAGSEWGIQEIGFDGVEKYMRPLDYSDHVAKLARKVDWRKLIGAEATYDNPDALPRDDGEEIEEKEPEEVVIGMEDRKTPEAGPWHTVAKYL |
Length | 105 |
Position | Head |
Organism | Onchocerca ochengi (Filarial nematode worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Onchocerca.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.695 |
Instability index | 50.94 |
Isoelectric point | 4.50 |
Molecular weight | 11611.74 |
Publications | PubMed=22919073
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP07781
No repeats found
No repeats found
|