<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07780
| Description |
Uncharacterized protein |
| Sequence | XPLDYSDHVAKLARKVDWRKLIGAEATYDNPDALPRDDGEEIEEKEPEEVVIGMEDRKTPEAGPWHTVAKYLHEALQQVNVLVDTISVLKTPYLEALTIADAFEVQHNMQDVIQQSKQFQWVTRRKALGEAIAVLEQAQKFRSKLLTETDPDKAMFFRELEKMRELWRVRKTGNVTYGDLGYKMFGSKYNPKELFDITRRTTTSASVGGSPSTRSDSCLQVQIPCDLIRRSTIAVSIEMG |
| Length | 240 |
| Position | Head |
| Organism | Onchocerca ochengi (Filarial nematode worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Onchocerca.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.531 |
| Instability index | 46.69 |
| Isoelectric point | 5.55 |
| Molecular weight | 27219.60 |
| Publications | PubMed=22919073
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07780
No repeats found
|