<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07756
Description |
Uncharacterized protein |
Sequence | MSDESITANYAMKWQGTFGKVHTDKQDILRMRGEDMKCITEEEYTKLMIFFCNFIHAIGMDSQQPHKTRMQVIATACVYFRRFYARRSLKDIDPFLLAPTSLFLASKVEEHGMMSHNKLIQATNNALKRWPFIQQDLMIRVQHIQEAEFFLLEILDCCLIVYHPYRPLNQLIAEMGREHKDLDTVSSYAWKICNDCTRTDLSLMYPPHQIAIACILIASVWTNRDRELKNWFAELAVDFEKVLEIQKIIINLYSVWKTFDEKEQLVAILQKIPRPNPGPQSSGTTMMQLHSHGGLQVNNMNVHQSVTMGPPPMPPVGNMKFETH |
Length | 324 |
Position | Kinase |
Organism | Onchocerca ochengi (Filarial nematode worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Onchocerca.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.241 |
Instability index | 50.22 |
Isoelectric point | 6.89 |
Molecular weight | 37595.31 |
Publications | PubMed=22919073
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP07756
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 93.71| 28| 98| 127| 173| 1
---------------------------------------------------------------------------
39- 74 (46.11/18.93) ITEEEYTKLMIFFCNFI..HaigmdsqqPHKTRMQVIA
144- 173 (47.61/ 6.64) IQEAEFFLLEILDCCLIvyH........PYRPLNQLIA
---------------------------------------------------------------------------
|