<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07721
Description |
Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MHSQEPGDVFSPADRIRQLNDIDKDVTKLLNAAGVAIRSLTTNSSSIALGQQSSDIPKIDGTLESHQAAFRAASSQYFALLSSIDVHLRRQVYALEEASIIKPESAETAGGGTTTTTIAAAASSGGVNPLDSSWLNSRKDTVGKDKEAELWAEASRLATQLDKDKGSYRNESGVLDRKGAFERNMEAD |
Length | 188 |
Position | Head |
Organism | Blastomyces gilchristii (strain SLH14081) (Blastomyces dermatitidis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Blastomyces.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.496 |
Instability index | 40.62 |
Isoelectric point | 5.14 |
Molecular weight | 20125.94 |
Publications | PubMed=26439490
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP07721
No repeats found
|