<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07716

Description Mediator of RNA polymerase II transcription subunit 8
SequenceMASISPEQLKVLEQTRQRLVQLTQSLASLINNINQSDPLPSWSSLQSQATIISNNLLNVSEQLTDHHDLLSSLVAYPTPQFPGRTEASMLSQLLRTKLEPRVEDWVSQGLSMGNADATRRRTGLTAEQLAELWQWAPVEANMEARKRNWGGDYTREEKEMGVKNVVTGLKRRLNEEDSGSESGSGDEDEGGKGEEGGGDGSGMQVVGVHRRAGAGGVQFDISSGGGQVPPVPMSPALPLQDVFRFMMTGASPKGR
Length255
PositionHead
OrganismBlastomyces gilchristii (strain SLH14081) (Blastomyces dermatitidis)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Ajellomycetaceae> Blastomyces.
Aromaticity0.04
Grand average of hydropathy-0.577
Instability index63.60
Isoelectric point5.13
Molecular weight27640.53
Publications
PubMed=26439490

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364144
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP07716
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      74.96|      17|      17|      70|      86|       1
---------------------------------------------------------------------------
   70-   86 (31.57/18.96)	LSSLVAYPTPQFPGRTE
   90-  103 (21.99/11.29)	LSQLLR..TKLEP.RVE
  110-  125 (21.40/10.81)	LSMGNADATRRRTGLT.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.34|      16|      21|      24|      39|       2
---------------------------------------------------------------------------
   24-   39 (28.08/19.39)	QSLASLINN..INQSDPL
   46-   63 (22.25/14.10)	QSQATIISNnlLNVSEQL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP07716 with Med8 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MGVKNVVTGLKRRLNEEDSGSESGSGDEDEGGKGEEGGGDGSGMQVVGVHRRAGAGGVQFDISSGGGQVPPVPMSPALPLQDVFRFMMTGASPKGR
160
255










Molecular Recognition Features






MoRF SequenceStartStop




1) PLQDVFRFMMTGASPKGR
238
255