<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07714
| Description |
RNA polymerase II holoenzyme cyclin-like subunit |
| Sequence | MAANFWVSTQRRHWLFERDQLAEIRRCLDEGEKQKQLLQQFPLPDLRYFSIYINLQLVRLGKRMTTRQQALATAQVYIRRFYTKVEIRRTNPYLVLTTAFYLACKMEECPQHIRFVVSEAKGLWPDFIVSDISKLGECEFWLISEMNSQLIVHHPYRTLSELQSTLSLTSDEVSLAWSVINDHYLTDLPLLQPPHVIAVTAILIAVVCKTSPASSANLAGASPVSATLRDGAGALAALGDKNLPPRIQKLVDWLSTGEVSIEAVIECTQELVSLYEAWVQYSEKACREQIGRYVKARSLDK |
| Length | 301 |
| Position | Kinase |
| Organism | Blastomyces gilchristii (strain SLH14081) (Blastomyces dermatitidis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Blastomyces.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.067 |
| Instability index | 58.60 |
| Isoelectric point | 7.60 |
| Molecular weight | 34289.19 |
| Publications | PubMed=26439490
|
Function
| Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The SRB8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The srb8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
ECO:0000256 ARBA:ARBA00002306
ECO:0000256 ARBA:ARBA00003882
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07714
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.54| 24| 24| 51| 74| 1
---------------------------------------------------------------------------
51- 74 (38.92/26.42) IYINLQLVRLGKRMTTRQQALATA
76- 99 (40.62/27.84) VYIRRFYTKVEIRRTNPYLVLTTA
---------------------------------------------------------------------------
|