Description | "RNA polymerase II holoenzyme cyclin-like subunit, variant" |
Sequence | MTTRQQALATAQVYIRRFYTKVEIRRTNPYLVLTTAFYLACKMEECPQHIRFVVSEAKGLWPDFIVSDISKLGECEFWLISEMNSQLIVHHPYRTLSELQSTLSLTSDEVSLAWSVINDHYLTDLPLLQPPHVIAVTAILIAVVCKTSPASSAHLAGASPVSATLRDGAGALAALGDKNLPPRIQKLVDWLSTGEVSIEAVIECTQELVSLYEAWVQYSEKACREQIGRYVKARSLDK |
Length | 238 |
Position | Kinase |
Organism | Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) (Blastomyces dermatitidis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Ajellomycetaceae> Blastomyces. |
Aromaticity | 0.08 |
Grand average of hydropathy | 0.071 |
Instability index | 56.55 |
Isoelectric point | 6.08 |
Molecular weight | 26566.32 |
Publications | PubMed=26439490 |
Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The SRB8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The srb8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
ECO:0000256 ARBA:ARBA00002306 ECO:0000256 ARBA:ARBA00003882 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07711 No repeats found |
MoRF Sequence | Start | Stop |
1) GRYVKARSLDK 2) VYIRRFY | 228 13 | 238 19 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab