<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07710

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMEPAGQNGMRTDHDRDLVINGVNGASAAGHEQVAPDKGKAPATASHHDAVNGGDSVGAAAPSGDQLSRMNDLPDEIVHITQGFVPLSLLLTRLAQVSHNSLQEKVAELAKMPIPGAAVNGNATYNSSGPDDNSNENLRKKASLASFAQDMHGKWLKALVIAEWSRKAGAVSKLIDLKFHIDQQRILYDATLDNVVNLKRDLTFARMPSPDLKTALQVLSTGSAPWIPDLGYLDPPPMTPTEEFKWFNDLNTLLSLRLNLEDYDKIPYAFRNYEIGSGRVTFKVDGEFEVDLTIADEDFDKQFWFIDFRYAFTPSASSLSDSLRSYLEGCVNDALSKDGLVGCYNFLHEFVLTCKINELKRQALLLSRGSWTGTLAVEPLNRSLAIQYWTPRTAITGTKSWVLIAINSGRQADGKPDPKSSSFLSAKWYRDSKEVKDVEIDLNVQHLSAESLLSNIVGRHIQSILTNTHDKLLSAARYKNRQASMVLDVSTSDPAASYLATQIGENNRACLLVEPTTGAFAVKPHSKFTVQYEHQLNTGKNPAEDGVACLENARCAIMEDDISRRGSSMGWFTRKAPLTIEEIKSATKLREWTRAIWLQKDGWGASWFVGVFLGLGGDEWWLLEANRDETNRPVKFKAKLALDKGYPDRGEEFWNNLALFATGIMTQSIDMRELLRHRIKNKSSAGAEVSLPHQVRIPCVKISLSALFPAMVSDTYQARSRSNSSGSDSGVKDAALSHLMQKYAGAALESKQAWAEDMVTINFKGIQSMRRPGEETKEGDTPTGVLVCESEAVIRVRRPSQLAALRNLMNRDVSYNVPRGEFSLRLRRPVGGPLLDTLKTRIKSIDRFINFFEALEKASGVITREAITLKFVAFSYSELPSTPPASGEDGQDDAPTTPPRRWRVGLDLSKDDIDIRIEDGNPHLRVVDLMRKLVNTDGGIGALMAWLPASLPALRAIDDMQSQWDSLTAEKRGRVEVSMKSIAWMSIAYTLPSPDSGGKDAQKRVTLEVRLKPKQGEAWWHVWRSDPGTKASPDDEFTKALKPVWASRGQGWLGLTTGAAGKPSGGVVGMLSAVDEAIRGAAQQVAAATTADGAKIKKEGGQQQEVVILD
Length1109
PositionTail
OrganismPurpureocillium lilacinum (Paecilomyces lilacinus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Purpureocillium.
Aromaticity0.07
Grand average of hydropathy-0.356
Instability index34.83
Isoelectric point6.60
Molecular weight121957.74
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU365082

GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP07710
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      86.29|      25|      29|     786|     810|       1
---------------------------------------------------------------------------
  786-  810 (42.48/26.27)	VCESEAVIRVRRPSQLAALRNLMNR
  816-  840 (43.81/27.32)	VPRGEFSLRLRRPVGGPLLDTLKTR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      97.49|      30|      33|    1032|    1064|       2
---------------------------------------------------------------------------
  983- 1004 (26.74/11.24)	...........WMSI...AYTLPSPDSG.GKDA.QKRV
 1010- 1039 (35.31/18.67)	LKP...KQGEAWWHVwrsDPGTKA....sPDDE.FTKA
 1040- 1069 (35.45/27.90)	LKPvwaSRGQGWLGL...TTGAAGKPSG.....gVVGM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.24|      17|      33|      13|      32|       3
---------------------------------------------------------------------------
   13-   32 (26.59/24.65)	HDrdlVINGVN..GASAAGHEQ
   47-   65 (27.65/16.29)	HD...AVNGGDsvGAAAPSGDQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.93|      10|      33|     921|     930|       4
---------------------------------------------------------------------------
  921-  930 (19.19/13.16)	PHLRVVDLMR
  951-  960 (18.74/12.67)	PALRAIDDMQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.02|      18|      37|     550|     571|       7
---------------------------------------------------------------------------
  550-  571 (29.87/22.74)	ENARCAIMEDDisrrGSSMGWF
  590-  607 (38.15/19.74)	EWTRAIWLQKD....GWGASWF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.92|      16|      31|      70|      85|      10
---------------------------------------------------------------------------
   70-   85 (28.01/22.64)	NDLPDEIVHITQGFVP
   99-  114 (25.91/20.30)	NSLQEKVAELAKMPIP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP07710 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MEPAGQNGMRTDHDRDLVINGVNGASAAGHEQVAPDKGKAPATASHHDAVNGGDSVGAAAPSGDQLSRMNDL
1
72










Molecular Recognition Features






MoRF SequenceStartStop




NANANA