<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07701
Description |
Surfeit locus protein 5 subunit 22 of mediator complex domain-containing protein |
Sequence | MDRSQPSSSNLMDNHNRLVADILTRYRTLMMLATVQAEGERNNATPETMAVSGISMKMEFDGLNSSIKDLLSLSRKIKELWVFGPLGQGDPDRKAKEAQIEEDVSQVSALLNGLEGGRMKELAERCGGSWDVLGKDDAAK |
Length | 140 |
Position | Head |
Organism | Pochonia chlamydosporia 170 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Clavicipitaceae> Pochonia.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.501 |
Instability index | 33.69 |
Isoelectric point | 5.07 |
Molecular weight | 15385.29 |
Publications | PubMed=27416025
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP07701
No repeats found
No repeats found
|