<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07691

Description RNA polymerase II transcription mediator
SequenceMGDRLTQLQDAVDQLAQQFVACLHFVQRRHDLETLGPNDKVRDVKQEPHQKEVDPLPADEFAAGLKELSRDLIIKEQQIEVLISNLPGLDNSERDQERNIKDLEEDLKAAEAQRQEALKERDQILAELDTVIRSIRRP
Length138
PositionMiddle
OrganismPochonia chlamydosporia 170
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Clavicipitaceae> Pochonia.
Aromaticity0.02
Grand average of hydropathy-0.788
Instability index54.03
Isoelectric point4.78
Molecular weight15897.66
Publications
PubMed=27416025

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	ARBA:ARBA00003669
ECO:0000256	RuleBase:RU366036
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP07691
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.92|      20|      20|      79|      98|       1
---------------------------------------------------------------------------
   79-   98 (33.47/20.89)	IEVLISNLPGLDNSERD..QER
  100-  121 (23.44/12.63)	IKDLEEDLKAAEAQRQEalKER
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP07691 with Med21 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




NANANA









Molecular Recognition Features






MoRF SequenceStartStop




1) VKQEPHQKEVDPLPADEFAAGLKELSRDLIIKEQQIEVLISNLPGLDNSERDQERNIKDLEEDLKAAE
44
111