<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07681
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MHEFALYGQVRKDDHHRMLQQLAGFARMQPQDAKEIHLVFKARQPPGVDLVQSIGASHLASQSQQDNIQRVKNMLNAGLYYVQLVGEVSPGTRAGVSENGDVTMTDVNGGQGAEKSSVKWSFEFKDTPDAGKQAVSSRLISRTPMEDGNFVQFLDHFGYDYVSRYIVVGSRFYDHDTTLFLHKVLRLPQIAADQAISDESFLSKLDHLPDVDGSGGYILQASIDVVDGNNPELKERATRQLLAIKEALRQAVDLSPGDRLALDTRLPITSRRA |
| Length | 273 |
| Position | Head |
| Organism | Fonsecaea erecta |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Fonsecaea.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.410 |
| Instability index | 38.08 |
| Isoelectric point | 5.98 |
| Molecular weight | 30307.71 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07681
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.29| 11| 19| 180| 190| 1
---------------------------------------------------------------------------
180- 190 (20.13/14.59) FLHKVLRLPQI
201- 211 (20.16/14.62) FLSKLDHLPDV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.10| 14| 15| 1| 14| 2
---------------------------------------------------------------------------
1- 14 (24.27/13.90) MHEFALYGQVRKDD
19- 32 (23.83/13.54) LQQLAGFARMQPQD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.04| 14| 19| 37| 54| 3
---------------------------------------------------------------------------
37- 54 (17.88/20.45) HLVFKARQppgvDLVQSI
58- 71 (24.15/13.61) HLASQSQQ....DNIQRV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.05| 18| 27| 219| 236| 4
---------------------------------------------------------------------------
219- 236 (29.64/16.79) LQASIDVVDGNNPELKER
248- 265 (29.41/16.61) LRQAVDLSPGDRLALDTR
---------------------------------------------------------------------------
|