<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07660
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MADHQQQHDEDLVLSFFPDPPPFYKHFTPENLERLKDIEQQAPDAGDDKGALPPKLSAEQILALPTELRYLIPPEPPADDEEFHVFGEATKAKGTDTFLKNMQFISTRVAEEGVLQAWKYEQLYPTSSSQAQLATGTLSTPPSSVDRQAYLFRFLRSILLSYMSLLGIVALNPVSPAKDDKTADILTLVTNMHALINEYRPHQARETLIAKMEEQVQRKRGEVEGVRKISERVREVLRGFGAEAPGEEGGKQGERDGKSEVGRASEEDKRRMGQRRMWRAMDELLG |
| Length | 286 |
| Position | Middle |
| Organism | Pyrenochaeta sp. DS3sAY3a |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Cucurbitariaceae>
Pyrenochaeta> unclassified Pyrenochaeta.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.656 |
| Instability index | 53.79 |
| Isoelectric point | 5.26 |
| Molecular weight | 32261.03 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07660
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 196.66| 60| 121| 60| 121| 1
---------------------------------------------------------------------------
60- 121 (98.11/70.34) QILALPTELRYLIPPEPPADDEEFHVFGEATKAKGTDTFLKNMQFISTRVAEegVLQAWKYE
184- 243 (98.56/64.41) DILTLVTNMHALINEYRPHQARETLIAKMEEQVQRKRGEVEGVRKISERVRE..VLRGFGAE
---------------------------------------------------------------------------
|