| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDPSAKRQRLDSTGRFSPASPPFDVAAKASGQPIQKPTHPRTPTSPPYPSMSSQPNGGYAVSSSTASSDKPSQSSDATTRSFSQAAMSVFARHPIATPASTTGVASVANIDSDGDAMMEDGPEDEAVRSSDYRRSNHNRQSESLWTRDGRLKASEGICGDQLFKLSTQTYEPSRPHPSQNLFKLYDLERLAHTVARNDPVTGEKINKLRKSYEGHIKTLQIAGKPKATKMDRVFLNPLSIPEEDWRLMKVQGKEVTKALNPDQMTLGPNMSKLLDSAFAGIAPGPLPPSDTAKYRAYIGTDDTVKPKPQDGPPNRTTPFASSAPTPSNIGQHRGPNRPERAGSKRHYTDAAFQGYGEGYGDEYADSTGGEDNAQGNMAKRRKLQFGGVSHPVEVGGARR |
| Length | 400 |
| Position | Head |
| Organism | Pyrenochaeta sp. DS3sAY3a |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Cucurbitariaceae> Pyrenochaeta> unclassified Pyrenochaeta. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.894 |
| Instability index | 57.52 |
| Isoelectric point | 9.32 |
| Molecular weight | 43242.40 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP07655
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.12| 13| 23| 19| 34| 1
---------------------------------------------------------------------------
19- 34 (21.51/14.78) PASPPFdvaAKASGQP
44- 56 (28.61/12.65) PTSPPY...PSMSSQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.07| 19| 21| 158| 178| 2
---------------------------------------------------------------------------
158- 178 (30.35/27.64) ICgdQLFKLSTQTYEPSRPHP
182- 200 (31.72/20.79) LF..KLYDLERLAHTVARNDP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.79| 13| 21| 310| 322| 3
---------------------------------------------------------------------------
310- 322 (25.08/13.02) QDGPPNRTTPFAS
332- 344 (23.71/11.87) QHRGPNRPERAGS
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) AKRQRLDSTGRFS 2) NMAKRRKLQFGGV 3) TAKYRAYIGTDD | 6 377 292 | 18 389 303 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab