Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSDPSAKRQRLDSTGRFSPASPPFDVAAKASGQPIQKPTHPRTPTSPPYPSMSSQPNGGYAVSSSTASSDKPSQSSDATTRSFSQAAMSVFARHPIATPASTTGVASVANIDSDGDAMMEDGPEDEAVRSSDYRRSNHNRQSESLWTRDGRLKASEGICGDQLFKLSTQTYEPSRPHPSQNLFKLYDLERLAHTVARNDPVTGEKINKLRKSYEGHIKTLQIAGKPKATKMDRVFLNPLSIPEEDWRLMKVQGKEVTKALNPDQMTLGPNMSKLLDSAFAGIAPGPLPPSDTAKYRAYIGTDDTVKPKPQDGPPNRTTPFASSAPTPSNIGQHRGPNRPERAGSKRHYTDAAFQGYGEGYGDEYADSTGGEDNAQGNMAKRRKLQFGGVSHPVEVGGARR |
Length | 400 |
Position | Head |
Organism | Pyrenochaeta sp. DS3sAY3a |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Cucurbitariaceae> Pyrenochaeta> unclassified Pyrenochaeta. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.894 |
Instability index | 57.52 |
Isoelectric point | 9.32 |
Molecular weight | 43242.40 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07655 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 50.12| 13| 23| 19| 34| 1 --------------------------------------------------------------------------- 19- 34 (21.51/14.78) PASPPFdvaAKASGQP 44- 56 (28.61/12.65) PTSPPY...PSMSSQP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 62.07| 19| 21| 158| 178| 2 --------------------------------------------------------------------------- 158- 178 (30.35/27.64) ICgdQLFKLSTQTYEPSRPHP 182- 200 (31.72/20.79) LF..KLYDLERLAHTVARNDP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 48.79| 13| 21| 310| 322| 3 --------------------------------------------------------------------------- 310- 322 (25.08/13.02) QDGPPNRTTPFAS 332- 344 (23.71/11.87) QHRGPNRPERAGS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AKRQRLDSTGRFS 2) NMAKRRKLQFGGV 3) TAKYRAYIGTDD | 6 377 292 | 18 389 303 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab