| Description | Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MHELLLYGQVPAGRHDQVLKILAGVAAMQPRRIIERRVLYKPLRDPEEPGSNLRRGGTQALAVKQTKQTVAPVLYYTKLIQKLSENDFGTGQGLPHDGAKSLSAYVDDAQDPVWSVLFEDFPDTGDRGVLVRFTNSTDLLSGDPHAIMVAKGPNRFVTEYYVEGHRLVHGNVVIYLHRVLHEPGVRNIQEAPKTELPSFSALELLDPSGAYILEAKVRVQEFNNTAVMEAGVNELKKFQKEMKGCVEVTLPDWLPLDTRVKYKSPHAAASMARPR |
| Length | 275 |
| Position | Head |
| Organism | Pyrenochaeta sp. DS3sAY3a |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Cucurbitariaceae> Pyrenochaeta> unclassified Pyrenochaeta. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.341 |
| Instability index | 36.50 |
| Isoelectric point | 7.85 |
| Molecular weight | 30686.80 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP07653
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.07| 18| 140| 36| 53| 1
---------------------------------------------------------------------------
36- 53 (33.61/20.85) RRVLYKP.LRDPEE.PGSNL
177- 196 (24.46/13.41) HRVLHEPgVRNIQEaPKTEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.63| 19| 40| 57| 75| 3
---------------------------------------------------------------------------
57- 75 (31.26/18.30) GTQALA..VKQTKQTVAPVLY
98- 118 (28.37/16.10) GAKSLSayVDDAQDPVWSVLF
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) RRIIERRVLYKPLR 2) VKYKSPHA | 31 260 | 44 267 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab