<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07648

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMNNSGSDAATAAREGDNRKRDYEGKLVNGNGASLAVSKPSESAMDLYSNLPPEIAEVPADAYNPISTLLVRMAQECYNDLTEVLDKMSDIPIAQQTNGSLPNGVSPHNAPNAPDNAKASSQKKLLLMKFAQDNRAKFIKLMVLTDWGKRSAADVAKFIDLYAWTREQSIHMEAADFAIDSVKRHASIVGEKNPDITTALEILSTGKASWMPSLDFIPRDPVSSEHALKLLRYMNASLSIRLNVHETLPRHLRNWRIQSGRATFVVDNQLEFDVMSFVEDTSQQWFFIDLRLLFSPAPAITVGSRFLMHLKEQADFTLRDKGLTGLFDFLNNFVLTHKITVLRSQALDLVRSGWAGSLKVEPVHRELVVSYWTDRPGKKNWIEIGVTTNKPKNGKVSWRGPPIPSLTARWFRQGKEVKDANLQFDWKDLSMERIIKQVIARHTGEILRLTKESLNPSMTVHANLSNTEPVACALSTTLGTKSNSITLSLEPVTGKYIMQPATALSARAEHALNLGREPSQIANILTQMLAQSLLSTVQRSAQQLGWQPVVRQSLNLQIIKEAVKLDALQFALYWPRGWSSTWAFATVIDSSGESWWVFEIGSNGVIDYAEQIKLDRPDGSSLVIDRKSLASLERVAVQLLSFRVTARQLEKEKKPCVLRYEIGETGASVTTQRIARRWVLYLRTIDVLTTKSGDQPWLESNIAVTCEGLRSEGRSVWHMASGRMVKSVAADMHKLMAASPQSNFSFSEDGRFRILLSTPFGEDILSELRARLRDVNRLRTFARTLQKRQMRLGSSSLQRVQFAYGPSPSIAAVNFSSEKEITLELSHNNPHSRVHRMLTEIANDRASFVTSTDPGDVNGLDRFCTILILTRSLLKALREVETRTPGNVRNPAVHAHTIFKYRITYENPICTFDVRLQPKDDHLYWSIEDCLKTRAPDARPTSERDKDHRRIDVLVVKLKEFFSTRGPGWFGTRQGIIAELDGVPDALKKLDEVVLSCKMEGGYKAPPPLEKSQAQQTQAQQQQQQQQQLAGAQGLPNGVQQQHQQQATMQARLQQQQQQARLHQQQQQQAQQQQAQNKGQQRKQPPQQMQRNQQANNARQMGQMGRGNAGGRPGGQGPGGGKQDVIEID
Length1128
PositionTail
OrganismPyrenochaeta sp. DS3sAY3a
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Cucurbitariaceae> Pyrenochaeta> unclassified Pyrenochaeta.
Aromaticity0.07
Grand average of hydropathy-0.475
Instability index48.42
Isoelectric point9.45
Molecular weight126440.26
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU365082

GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP07648
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      75.07|      17|      17|    1039|    1055|       1
---------------------------------------------------------------------------
 1039- 1053 (25.61/10.70)	........QQQ...HQQQATMQARLQ
 1054- 1070 (24.56/ 9.99)	QQ......QQQarlHQQQ...QQQAQ
 1071- 1092 (24.90/10.22)	QQqaqnkgQQR...KQPPQQMQ.RNQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      70.52|      17|      17|     143|     159|       2
---------------------------------------------------------------------------
  126-  142 (24.04/15.47)	LMKFAQDNR..AKFIKL.MV
  143-  159 (27.77/19.20)	LTDWGKRSA..ADVAKF.ID
  160-  179 (18.72/10.14)	LYAWTREQSihMEAADFaID
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.15|      16|      16|     600|     615|       3
---------------------------------------------------------------------------
  600-  615 (28.17/19.21)	GSNGVIDYAEQIKLDR
  618-  633 (25.98/17.17)	GSSLVIDRKSLASLER
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.98|      16|      17|     365|     380|       4
---------------------------------------------------------------------------
  365-  380 (31.13/17.50)	ELVVSYWTDRPGKKNW
  382-  397 (28.85/15.74)	EIGVTTNKPKNGKVSW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.19|      24|      29|     489|     517|       5
---------------------------------------------------------------------------
  204-  231 (39.37/19.91)	TGKASWMPSLDFIPRdpvsSEHALKLLR
  492-  515 (42.83/26.95)	TGKYIMQPATALSAR....AEHALNLGR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.26|      16|      29|     920|     935|       6
---------------------------------------------------------------------------
  920-  935 (31.09/22.09)	DHLYWSIEDCLKTRAP
  951-  966 (27.17/18.37)	DVLVVKLKEFFSTRGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      33.92|      11|      18|     314|     325|      10
---------------------------------------------------------------------------
  314-  325 (14.87/15.04)	DFTLRDKgLTGL
  331-  341 (19.06/12.48)	NFVLTHK.ITVL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP07648 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) CKMEGGYKAPPPLEKSQAQQTQAQQQQQQQQQLAGAQGLPNGVQQQHQQQATMQARLQQQQQQARLHQQQQQQAQQQQAQNKGQQRKQPPQQMQRNQQANNARQMGQMGRGNAGGRPGGQGPGGGKQDVIEID
2) MNNSGSDAATAAREGDNRKRDYEGKLVNGNGASLA
996
1
1128
35










Molecular Recognition Features






MoRF SequenceStartStop




1) QRKQPPQQMQR
2) VIEID
1080
1124
1090
1128