<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07643

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMDDVLSAQFDRVEKALSTLVDSIAAYNPSPQAALDLVAADDELSHGLDQLARHQANHARIQSLRAEADALEEQLKASVSALASLRHELFETPATTLPTDTRPVHFDELLQYAKNISQHTVPPTFREHAPQSAADKDKDNEDAASSAAPTNGVNTPANQPALLDTQEPKETENAANAPAEITAEEEEWLKKLKDSKIAWYPWPSNDKIQTGNLYKLMYWQAMGKDADDFDIYAHEEAERLKSLSGDQPPGPSPVPEPVQEPQPPPEAAPRPVPKPSRPRETFDAFDDLDDE
Length290
PositionMiddle
OrganismStagonospora sp. SRC1lsM3a
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Massarineae> Massarinaceae> Stagonospora> unclassified Stagonospora.
Aromaticity0.06
Grand average of hydropathy-0.790
Instability index52.54
Isoelectric point4.50
Molecular weight31953.67
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364141

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP07643
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.50|      12|      16|     148|     162|       1
---------------------------------------------------------------------------
  148-  160 (18.66/17.04)	PTNGVNTpANQPA
  167-  178 (21.84/ 7.19)	PKETENA.ANAPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      87.49|      25|      52|     183|     208|       2
---------------------------------------------------------------------------
  183-  208 (41.88/25.17)	EEEEWLKKLKDSKIAwYPWPSNDKIQ
  234-  258 (45.60/22.37)	EEAERLKSLSGDQPP.GPSPVPEPVQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.49|      16|      17|      86|     102|       3
---------------------------------------------------------------------------
   86-  102 (24.45/19.55)	H..ELFETpATTLPTDTRP
  104-  121 (24.05/13.38)	HfdELLQY.AKNISQHTVP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP07643 with Med4 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) DADDFDIYAHEEAERLKSLSGDQPPGPSPVPEPVQEPQPPPEAAPRPVPKPSRPRETFDAFDDLDDE
2) SQHTVPPTFREHAPQSAADKDKDNEDAASSAAPTNGVNTPANQPALLDTQEPKETENAANAPAEITAEEEEW
224
116
290
187










Molecular Recognition Features






MoRF SequenceStartStop




1) PSRPRETFDAFDDLDDE
274
290