<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07643
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MDDVLSAQFDRVEKALSTLVDSIAAYNPSPQAALDLVAADDELSHGLDQLARHQANHARIQSLRAEADALEEQLKASVSALASLRHELFETPATTLPTDTRPVHFDELLQYAKNISQHTVPPTFREHAPQSAADKDKDNEDAASSAAPTNGVNTPANQPALLDTQEPKETENAANAPAEITAEEEEWLKKLKDSKIAWYPWPSNDKIQTGNLYKLMYWQAMGKDADDFDIYAHEEAERLKSLSGDQPPGPSPVPEPVQEPQPPPEAAPRPVPKPSRPRETFDAFDDLDDE |
| Length | 290 |
| Position | Middle |
| Organism | Stagonospora sp. SRC1lsM3a |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Massarineae> Massarinaceae> Stagonospora>
unclassified Stagonospora.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.790 |
| Instability index | 52.54 |
| Isoelectric point | 4.50 |
| Molecular weight | 31953.67 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07643
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.50| 12| 16| 148| 162| 1
---------------------------------------------------------------------------
148- 160 (18.66/17.04) PTNGVNTpANQPA
167- 178 (21.84/ 7.19) PKETENA.ANAPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 87.49| 25| 52| 183| 208| 2
---------------------------------------------------------------------------
183- 208 (41.88/25.17) EEEEWLKKLKDSKIAwYPWPSNDKIQ
234- 258 (45.60/22.37) EEAERLKSLSGDQPP.GPSPVPEPVQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.49| 16| 17| 86| 102| 3
---------------------------------------------------------------------------
86- 102 (24.45/19.55) H..ELFETpATTLPTDTRP
104- 121 (24.05/13.38) HfdELLQY.AKNISQHTVP
---------------------------------------------------------------------------
|