| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MMPAAHAQREGTPLSPSPSPPASPGRGGRTGERVVIDLTDSPPPPPSTAQHAQSHAARTAAAAAAAAGIIGGADGRYAHPNPASLIPDDPNQPSFYRTAAAHFPPPSEAHAQLEENSKAVVGAFYDLAVRAADVERGNEHLVLEQVNHTIQALANLSHLARRPEINATLVNPEALNMVDDSRNPDTHSRTLVNRLVSDNQQMRGQSIALHSYQSKLTAALSSAFPALAGHLPPVPDRPVWTESRSNANGTS |
| Length | 251 |
| Position | Middle |
| Organism | Tilletia controversa (dwarf bunt fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina> Exobasidiomycetes> Tilletiales> Tilletiaceae> Tilletia. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.476 |
| Instability index | 53.69 |
| Isoelectric point | 6.29 |
| Molecular weight | 26414.93 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP07613
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.93| 20| 21| 151| 171| 1
---------------------------------------------------------------------------
151- 171 (30.14/22.35) QALaNLSHLARRPEINA.TLVN
173- 193 (31.80/18.93) EAL.NMVDDSRNPDTHSrTLVN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 134.08| 31| 59| 44| 74| 2
---------------------------------------------------------------------------
4- 27 (33.93/12.07) .....AAHAQREGTPLSPSPSPPAS..PGRG
44- 74 (51.43/21.70) PPPSTAQHAQSHAARTAAAAAAAAGIIGGAD
104- 133 (48.71/20.20) PPPSEA.HAQLEENSKAVVGAFYDLAVRAAD
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) HAARTAAAAAAA 2) RVVIDLT | 55 33 | 66 39 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab