<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07603
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MMSAAHAQREGTPLSPSPSPPGTPGGRAGGMGERVVIDLTDSPPPSASHLAQAQAAAAGTTATGGAAGGGRLPYSTHPNPASLIPDDPNQPSFYRTAAAHFPPPSEAHAQLEENSKAVVGAFYDLAVRAADVDRGNEHLVLEQVNHTIQALANLSHLARRPEINATLINPEALHLVDDSRNPDTQSRTLVNRLVSDNQQMRGQSIALHSYQSKLTAAISSAFPALAGHLPPVPDRPVWTESRSSTNGTS |
| Length | 249 |
| Position | Middle |
| Organism | Tilletia walkeri |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Exobasidiomycetes> Tilletiales> Tilletiaceae> Tilletia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.434 |
| Instability index | 50.43 |
| Isoelectric point | 6.09 |
| Molecular weight | 26019.46 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07603
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.12| 16| 20| 159| 178| 1
---------------------------------------------------------------------------
159- 178 (23.70/26.72) RRPEINA.TLINpealHLVDD
180- 196 (24.41/15.56) RNPDTQSrTLVN....RLVSD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 153.16| 45| 58| 13| 59| 2
---------------------------------------------------------------------------
13- 59 (78.12/37.23) PLSPSPSPPG.TPGGRAGGMGERVVIdlTDSPPPSASH..LAQAQAAAAG
73- 120 (75.03/31.44) PYSTHPNPASlIPDDPNQPSFYRTAA..AHFPPPSEAHaqLEENSKAVVG
---------------------------------------------------------------------------
|