<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07600

Description Uncharacterized protein
SequenceMRDLPPPPSSSSASAAMAAYRAQRDAVRKPILDTYSILGFLSSGTYGRVYKARLKRDEHSSASGSATSRSGRGNGPAGKDNTIRERDDAEVFAIKKFKPDKESEMVYVGISQSAMREIALNRELSHENVITLREVLLEDKAIYMVFEYAEHDFLQLIHHHSTVLRAPIPAAVLKSLLWQLINGVAYLHANWVLHRDLKPANILVTSSGRVKIGDLGLARLYSAPLQPLFKGDKVVVTIWYRAPELLLGAQHYTPAIDMWAIGCIWGELLFLRPMFKGEEAKIDPKNNKSAPFQTDQLKKIVEILGTPTAEQWPGLEAMPEYKGWWAHLQVEHYSCSLPHWYTSKAKNTSGLSLFEALLQYDPAKRLTAGQALEHSWFTSEEPFPTLDAFAALPNPRTTYPSRRVIHDESDPKMSSNAAAAAAANQAAVAAAAAAAAQQQAVAAAAAAAVATTNAGPPAPPPLPMDVGSGPSQAQYQSQQNARAVGRKQAKRPRVG
Length495
PositionKinase
OrganismTilletia walkeri
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina> Exobasidiomycetes> Tilletiales> Tilletiaceae> Tilletia.
Aromaticity0.08
Grand average of hydropathy-0.289
Instability index40.70
Isoelectric point9.18
Molecular weight54087.98
Publications









Function






Annotated function


GO - Cellular Component
euchromatin	GO:0000791	IEA:EnsemblFungi
mediator complex	GO:0016592	IEA:EnsemblFungi

GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
cyclin-dependent protein serine/threonine kinase activity	GO:0004693	IEA:EnsemblFungi

GO - Biological Process
positive regulation of transcription by RNA polymerase II	GO:0045944	IEA:EnsemblFungi









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP07600
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.14|      16|      23|     416|     433|       1
---------------------------------------------------------------------------
  416-  433 (21.17/15.92)	NAAAAAAAnqAAVAAAAA
  439-  454 (26.97/13.83)	QAVAAAAA..AAVATTNA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.92|      22|     452|       5|      26|       2
---------------------------------------------------------------------------
    5-   26 (39.89/18.31)	PPP.PSSSSASAAMAAYRAQRDA
  459-  481 (39.03/17.79)	PPPlPMDVGSGPSQAQYQSQQNA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     110.83|      36|     132|     220|     260|       5
---------------------------------------------------------------------------
  220-  259 (60.90/49.04)	LYSA..PLQPLFKGDKVVV......TIWYRAPEL.....LLGaqhyTPAIDMW
  264-  312 (49.93/26.45)	IWGEllFLRPMFKGEEAKIdpknnkSAPFQTDQLkkiveILG....TPTAEQW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      85.19|      26|      33|     337|     367|       6
---------------------------------------------------------------------------
  337-  367 (38.57/35.53)	LPH.WYTSKaKNTSGLSLFEALlqydPAKRLT
  372-  398 (46.62/27.23)	LEHsWFTSE.EPFPTLDAFAAL....PNPRTT
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP07600 with CDK8 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) AAAAVATTNAGPPAPPPLPMDVGSGPSQAQYQSQQNARAVGRKQAKRPRVG
445
495










Molecular Recognition Features






MoRF SequenceStartStop




1) YQSQQNARAVGRKQA
475
489