<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07599
Description |
Mediator of RNA polymerase II transcription subunit 5 |
Sequence | MEQTQRLEAVSIFAQRLASDDPNLVLAEFLAEDAGIQSTLASQIVSRLSTLSDAADFDSLSRLCRALLGNLRALDVVVNHVGCKRLLDPVSIFLRDERQAEEADDVSILASHLFFAQALVQRQQSLKTKESPTPIPMLEEYLRVRSLSYQLNQLNENERDLIGRWVTALFDSEGISDELSRDSPPRTMLKLAPTLFSQSIAACATGIVDLDTLRGALTYFLQDLLSYTLPGPIIWLLRQLTHYPPPSPESPTNLGSSHAFGAEAKMRWCLYLDILAMLLLADTCPESVIVVTAPALRALFSPQIRLRAVREGKQGELTALCSRIVAVLTGQHR |
Length | 333 |
Position | Tail |
Organism | Tilletia walkeri |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Exobasidiomycetes> Tilletiales> Tilletiaceae> Tilletia.
|
Aromaticity | 0.06 |
Grand average of hydropathy | 0.056 |
Instability index | 50.50 |
Isoelectric point | 5.25 |
Molecular weight | 36853.94 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364142
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP07599
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 270.27| 88| 100| 103| 200| 1
---------------------------------------------------------------------------
103- 200 (137.61/101.62) AD...DVSILASHL.FFAQALVqrqqslkTKESPTPIPMLEEYLRVRSLSYQLNQLNENERDLIG.....RWVTALfdsEGISDELSRDSPPRTMLKL.AP...TLFSQSI
204- 304 (132.66/78.96) ATgivDLDTLRGALtYFLQDLL.......SYTLPGPIIWLLRQLTHYPPPSPESPTNLGSSHAFGaeakmRWCLYL...DILAMLLLADTCPESVIVVtAPalrALFSPQI
---------------------------------------------------------------------------
|