<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07597

Description Mediator of RNA polymerase II transcription subunit 7
SequenceMDVHTDTDAVAHPQEAGSADPNTAAAAPAALESSVFPAPPADYLLFTSKNDDLAKALAPPRVDWIEEDGYYSYLGDRWPIPEVHPTLEQQGVTRLYPDGPHDRRAILQSLLQTTLRTYLELVATLQRPPQEYLAVEEYPISPVPGAGEAPPAEGGQQAPQQMQRVEVWRSDAQDQWEHLRTAVINMQDTINRSRPVQARDSLKTLMQLQLDRRIAQTEHLRKKCAELRAEIATMHDACQSDEAEGGPAPDVR
Length252
PositionMiddle
OrganismTilletia walkeri
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina> Exobasidiomycetes> Tilletiales> Tilletiaceae> Tilletia.
Aromaticity0.06
Grand average of hydropathy-0.633
Instability index66.77
Isoelectric point4.77
Molecular weight28013.89
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. 


ECO:0000256	RuleBase:RU364060

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP07597
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.26|      19|      88|     140|     159|       1
---------------------------------------------------------------------------
  140-  159 (32.57/18.42)	ISPVPGAGEAPPAEGGQqAP
  231-  249 (36.69/17.22)	IATMHDACQSDEAEGGP.AP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.57|      17|      19|      53|      69|       2
---------------------------------------------------------------------------
   53-   69 (30.07/14.51)	LAKALAPPRV.DWIEEDG
   74-   91 (26.50/12.05)	LGDRWPIPEVhPTLEQQG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      96.69|      21|      21|     161|     181|       3
---------------------------------------------------------------------------
  161-  181 (40.18/24.87)	QMQRVEVWRSDAQDQWEHLRT
  185-  204 (32.23/18.66)	NMQDT.INRSRPVQARDSLKT
  205-  221 (24.27/12.45)	LMQ.LQLDRRIAQT..EHLR.
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP07597 with Med7 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) EEYPISPVPGAGEAPPAEGGQQAPQQMQRVEVWRS
2) MDVHTDTDAVAHPQEAGSADPNTAAAAPAAL
136
1
170
31










Molecular Recognition Features






MoRF SequenceStartStop




NANANA