<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07595
Description |
Uncharacterized protein |
Sequence | MAGSLSYCTLRASHVTIHPEIPISAKEATRASAKLVELDEMQGAIDELVLDLVRKAKDVEGLIATLPDGLQSEEDQTTELAALDNRIRTANADFKLALEEAESLQSQLTALLRNVQHQQQLTRLHLQRSLAAPPSQKPPLPSS |
Length | 143 |
Position | Middle |
Organism | Tilletia walkeri |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Exobasidiomycetes> Tilletiales> Tilletiaceae> Tilletia.
|
Aromaticity | 0.01 |
Grand average of hydropathy | -0.292 |
Instability index | 55.69 |
Isoelectric point | 5.16 |
Molecular weight | 15598.52 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP07595
No repeats found
No repeats found
|