<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07592
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MSGSRADGNAMAVRATSEAPLGSQLRAALDAYEESTLSLFAAIENGSAFESSNSSNNKNDGAEQQQPLHALLSTIHRLDEHLQSSLIHRLLPTHTAQQHTIDALVRLQRARDQDRKTQIERLSRMKADLDLLVSRGREEKIAAEKAETEPLSYKHILNYASYLSRTTSAPPGHRPPGFGLGAAVKDEQLSDQQQQQQMDWPFPSEAQMRRGALAAAAVAVARTDELHRPSEAGPTGEGAAAAAAATGGTAVAAAAGLDVQHAPQNFPLPGQPDHPSQQHHHHHHQQQEQVEMEEDAFDLDLN |
Length | 302 |
Position | Middle |
Organism | Tilletia controversa (dwarf bunt fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Exobasidiomycetes> Tilletiales> Tilletiaceae> Tilletia.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.684 |
Instability index | 54.61 |
Isoelectric point | 5.59 |
Molecular weight | 32724.60 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP07592
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 93.75| 29| 31| 201| 229| 2
---------------------------------------------------------------------------
201- 229 (50.23/30.78) PFPSEAQMRRGALAAAAVAVAR.TDELHRP
234- 263 (43.52/25.67) PTGEGAAAAAAATGGTAVAAAAgLDVQHAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.67| 13| 15| 100| 114| 3
---------------------------------------------------------------------------
100- 114 (17.02/14.72) TIDALVRLQRarDQD
118- 130 (20.65/10.94) QIERLSRMKA..DLD
---------------------------------------------------------------------------
|