<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07591
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MDPMSVDNPAPNPSNDLILSPEDADQPQQPPPPPPPTQAEREANQLRFSTELEFVSALSSPAYLVSLAQRGFLQQPRFVRYLHYLAQHWRTRDYARFVRYPAGLTMLEYLLEEEFRGAVGSEGWEEMARGKMIGHWATWRTATAT |
Length | 145 |
Position | Middle |
Organism | Tilletia walkeri |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Exobasidiomycetes> Tilletiales> Tilletiaceae> Tilletia.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.606 |
Instability index | 58.11 |
Isoelectric point | 5.16 |
Molecular weight | 16561.41 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP07591
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.28| 15| 16| 67| 81| 1
---------------------------------------------------------------------------
67- 81 (29.31/17.71) LAQRGFLQQ.PRFVRY
85- 100 (25.97/15.04) LAQHWRTRDyARFVRY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.04| 13| 16| 1| 13| 2
---------------------------------------------------------------------------
1- 13 (26.01/15.61) MDPMSVDNPAPNP
19- 31 (25.03/14.76) LSPEDADQPQQPP
---------------------------------------------------------------------------
|