<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07590

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMNVNGGAHAQSQGRGGPAVNAGGSSITTPSYQTNGVSELGSSKGGGAPATAGAMPPPSSLPTPAAVKSEKAQGKARQVDEPNSMQWLPTNGSSHPVSYDDTPPEALLSELLPQTENLVPLAAIVERMSNYGYEALQILSETMSSLPSDQRREKIFMTAVTVQRQIAKLVALALWSRLSGDLQKARDTVGLLCEQFAQAEDAVKELTSIRTMLPHSRLRNFDLISAMDVLRTGAYIRLPSTIKTSAMHETPMDDKAVDELVEELEDAIRLRLSCHDILPLQMSDYRIADGRAHFDVPNLFEASLTVDGPFPSGRWYLLTIKFHFRVTGTGKDHFPRVPKKHFRDMLLEQVNAELAPPPPPPLPPEADPTDAQDDAASSGQPPPLVKFFRHLESRALQYQLDILGFQAGELGHGTWKGHLAVERDSQTQALRLTYWSQLRSKADTARSGRLAAAQSWRNGGSITVSIETDQGNKCTARSIAQVLFGGAEVDDVDSLYRKRLAVDWRVDKSIKEGSRQSFTVDVHALNIRTLLLDVVSAHAHAILDNLRSKILRSSLLLGVGDDDCTLRLAQVEGEKDSFPRLRVKLCGAMSLCIALHAVSGQISIEEDVIRVPDAFLSSETGTKADAAIFAQSTERLNRDPDQVVEVLQALRQYAICKDLEQKACFLGLEAVQRLPFQPNEYGKLEAPPEAVLFLSLPQCPHWYLAAQFSAHPPRLALLSTTTYVLHGQIFMVVNTLQWINRSKVLTSLLKSDSISNEEVQQSLADIDLDEIAHLHWYGVAIVSYFRIEQQLQNRGLPFSHTTSLPPMALDQVVSGKVRMDAPVTKVASKIPAICIRSADALGPSSALVKPNMFVRLSKWWDRAACSAQIVVRLSLRSASMMTKLEPPGGGGTIEYDAASRQLTFSTADIDNCITWFLVEWDRFARIGMLVKAVERARAFPGGRARGWKVTNFNFFQASFSYAHGRYATVTWSRSVPGHAVPESYLLRMYADRPKKGADQGKAMQVDDEDADAGQNPHECVEAALEQNLNVGSSYSPGFWPSFLCLLHETLPVLEILRDACKDELSDANAPTLELRSACWYRLTYGSRHALDVRYLTGSRFIIADAARPLFGASLSEAASGFACLPAFHRTTKEAVASYYTLAKQFAASNGVATKGSKLASVEAPDGNPQTSTELQQGTNRLAPSPAAVDLRRAVLCAADEAVVGPILSAVLASVREQLKIAAAGAAVDVEAVPAAVGVATS
Length1240
PositionTail
OrganismTilletia controversa (dwarf bunt fungus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina> Exobasidiomycetes> Tilletiales> Tilletiaceae> Tilletia.
Aromaticity0.07
Grand average of hydropathy-0.166
Instability index43.86
Isoelectric point6.20
Molecular weight135081.98
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU365082

GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP07590
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     107.49|      22|      22|     673|     694|       1
---------------------------------------------------------------------------
   87-  110 (29.50/13.70)	LPTngssHPVSY..D..DTPPEALLSEL
  673-  694 (40.24/21.29)	LPF....QPNEY..GKLEAPPEAVLFLS
  695-  718 (37.75/19.52)	LPQ....CPHWYlaAQFSAHPPRLALLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.37|      12|      22|     348|     359|       2
---------------------------------------------------------------------------
  348-  359 (23.97/10.47)	QVNAELAPPPPP
  371-  382 (23.40/10.05)	QDDAASSGQPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      86.14|      20|      26|      41|      60|       4
---------------------------------------------------------------------------
   11-   26 (19.29/ 6.18)	.SQGRGGPAvNAGG....SSI
   41-   60 (38.32/19.50)	SSKGGGAPA.TAGAMPPPSSL
   68-   84 (28.53/12.64)	SEKAQG....KARQVDEPNSM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.96|      13|      15|    1104|    1116|       6
---------------------------------------------------------------------------
 1104- 1116 (21.71/11.20)	AARPLFGASLSEA
 1121- 1133 (24.25/13.34)	ACLPAFHRTTKEA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.76|      12|      28|     443|     459|       7
---------------------------------------------------------------------------
  443-  459 (14.30/16.25)	TARSgrlaAAQSWRnGG
  474-  485 (22.46/ 8.97)	TARS....IAQVLF.GG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      77.31|      16|      28|     198|     213|       9
---------------------------------------------------------------------------
  198-  213 (26.53/19.15)	AEDAVKELTSIRTMLP
  225-  238 (23.71/16.20)	AMDVLRTGAYIR..LP
  263-  278 (27.07/19.70)	LEDAIRLRLSCHDILP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP07590 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) EQVNAELAPPPPPPLPPEADPTDAQDDAASSG
2) MNVNGGAHAQSQGRGGPAVNAGGSSITTPSYQTNGVSELGSSKGGGAPATAGAMPPPSSLPTPAAVKSEKAQGKARQVDEPNSMQWLPTNGSSHPVSYDDTPPEALLSELL
347
1
378
111










Molecular Recognition Features






MoRF SequenceStartStop




NANANA