<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07581
| Description |
Mediator of RNA polymerase II transcription subunit 17 |
| Sequence | MDSLNNVALRPWPAPKKEELTQDDLLFKIEQLASERGHLRNITEQSLQEDIDAGKHVPADAEEGAKDEKKDKEVPSRQEQLEKVFKAGQEMYSHLEWAKFAATNALDLVSLVLSQDPNKRSLNFFSPTFRDQGLNQGIPLGSFGISKENHEHRTRKVEEQHRLQDLASKQEAAAQGARMGALDSSVDEILKAAKHLEKEIRRETKYWHEIVSVSDKGWPIQRLRQNVRHAPFAVRYGLPEASDHFKARGFAPLQMDKDGSIILDPALALKPKTFRVRVSIDGKITGTSQIPVDGDFATRSLEKSIQLARDSLLEEELYYEMSLETRQLLAYGVAFRDSVIHIDAPQMGSAFQDRKLLIDCIPRDDPIASNEGHEHDWLARNIAEALRLLLAHEHSMRLHRRSQLPPPLTGQTREKLPPPLLRTLLAILNHIAGVDSLYAYLDLVTKTLKGAGLDATLETTRETSWANLVESLKTTSRKGLSATDQLLEIFMKPFDGKATLTLPTSNSAQPENLIVVTRTIIGQPTFGTEHKLTLPSTLTSDIGLFQQHKFDSVTELKSYLDWILSLHIAHRLLKGEYASRAQTRTQDPRLSIRTKDSKKGTKLTKDIKVDFNDGELKVTALAVDTIAESGDSEQSHVWSGAAGSTSLKEVVQEWVG |
| Length | 656 |
| Position | Head |
| Organism | Alternaria alternata (Alternaria rot fungus) (Torula alternata) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Alternaria>
Alternaria sect. Alternaria> Alternaria alternata complex.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.500 |
| Instability index | 41.28 |
| Isoelectric point | 6.29 |
| Molecular weight | 73492.38 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07581
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.39| 15| 15| 332| 346| 1
---------------------------------------------------------------------------
332- 346 (27.93/17.64) GVAFRDSVIHIDA.PQ
348- 363 (24.46/14.63) GSAFQDRKLLIDCiPR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.19| 12| 16| 55| 69| 2
---------------------------------------------------------------------------
55- 66 (20.79/16.99) KHVPADAEEGAK
72- 83 (20.40/ 6.94) KEVPSRQEQLEK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.44| 15| 15| 601| 615| 3
---------------------------------------------------------------------------
601- 615 (25.05/19.88) TKLTKDIKVDFNDGE
619- 633 (23.39/18.02) TALAVDTIAESGDSE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.99| 17| 25| 440| 456| 9
---------------------------------------------------------------------------
440- 456 (28.95/20.29) YLDLV..TKTLKGAGLDAT
465- 483 (25.04/16.53) WANLVesLKTTSRKGLSAT
---------------------------------------------------------------------------
|