Description | Mediator of RNA polymerase II transcription subunit 17 |
Sequence | MDSLNNVALRPWPAPKKEELTQDDLLFKIEQLASERGHLRNITEQSLQEDIDAGKHVPADAEEGAKDEKKDKEVPSRQEQLEKVFKAGQEMYSHLEWAKFAATNALDLVSLVLSQDPNKRSLNFFSPTFRDQGLNQGIPLGSFGISKENHEHRTRKVEEQHRLQDLASKQEAAAQGARMGALDSSVDEILKAAKHLEKEIRRETKYWHEIVSVSDKGWPIQRLRQNVRHAPFAVRYGLPEASDHFKARGFAPLQMDKDGSIILDPALALKPKTFRVRVSIDGKITGTSQIPVDGDFATRSLEKSIQLARDSLLEEELYYEMSLETRQLLAYGVAFRDSVIHIDAPQMGSAFQDRKLLIDCIPRDDPIASNEGHEHDWLARNIAEALRLLLAHEHSMRLHRRSQLPPPLTGQTREKLPPPLLRTLLAILNHIAGVDSLYAYLDLVTKTLKGAGLDATLETTRETSWANLVESLKTTSRKGLSATDQLLEIFMKPFDGKATLTLPTSNSAQPENLIVVTRTIIGQPTFGTEHKLTLPSTLTSDIGLFQQHKFDSVTELKSYLDWILSLHIAHRLLKGEYASRAQTRTQDPRLSIRTKDSKKGTKLTKDIKVDFNDGELKVTALAVDTIAESGDSEQSHVWSGAAGSTSLKEVVQEWVG |
Length | 656 |
Position | Head |
Organism | Alternaria alternata (Alternaria rot fungus) (Torula alternata) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Alternaria> Alternaria sect. Alternaria> Alternaria alternata complex. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.500 |
Instability index | 41.28 |
Isoelectric point | 6.29 |
Molecular weight | 73492.38 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07581 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 52.39| 15| 15| 332| 346| 1 --------------------------------------------------------------------------- 332- 346 (27.93/17.64) GVAFRDSVIHIDA.PQ 348- 363 (24.46/14.63) GSAFQDRKLLIDCiPR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 41.19| 12| 16| 55| 69| 2 --------------------------------------------------------------------------- 55- 66 (20.79/16.99) KHVPADAEEGAK 72- 83 (20.40/ 6.94) KEVPSRQEQLEK --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 48.44| 15| 15| 601| 615| 3 --------------------------------------------------------------------------- 601- 615 (25.05/19.88) TKLTKDIKVDFNDGE 619- 633 (23.39/18.02) TALAVDTIAESGDSE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.99| 17| 25| 440| 456| 9 --------------------------------------------------------------------------- 440- 456 (28.95/20.29) YLDLV..TKTLKGAGLDAT 465- 483 (25.04/16.53) WANLVesLKTTSRKGLSAT --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DDLLFKIEQL 2) VALRPW | 23 7 | 32 12 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab