Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MDDLQRPPTPEDEDIKLNFFPDPPPFYKYFTTENLARLKDIEKEAAPENDDAQPSTSKAATKLSAEQILALPTELRYLIPPEPPADDAEFHVFGAVESAKGANNLMKNMDYIADQLRFQDVFHDWTYEQLYPSPSTEPSADDPSAQQPTTSNSASLDRQNYLFRFLRSILLSYISLLGIVAANPTSEQKEQKLKDIMTLVANMHALINEYRPHQARQTLIAKMEEQVRKKREEIESVKRIGEKVKEVLAGFGGVDGENKPSDGGEETLEDGTRAREEDRQRVQRGMWDAINEVVG |
Length | 295 |
Position | Middle |
Organism | Alternaria alternata (Alternaria rot fungus) (Torula alternata) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Alternaria> Alternaria sect. Alternaria> Alternaria alternata complex. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.749 |
Instability index | 52.65 |
Isoelectric point | 4.74 |
Molecular weight | 33385.87 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07571 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 124.69| 37| 78| 30| 67| 1 --------------------------------------------------------------------------- 30- 67 (55.96/39.27) FTTENLaRLKDIEKEAAPENDDAQPSTSKAATKLSAEQ 111- 147 (68.73/44.41) YIADQL.RFQDVFHDWTYEQLYPSPSTEPSADDPSAQQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 55.19| 14| 71| 7| 20| 2 --------------------------------------------------------------------------- 7- 20 (27.04/15.47) PPTPEDEDIKLNFF 80- 93 (28.14/16.39) PPEPPADDAEFHVF --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ILALPTELRYLIP 2) MDDLQRPPTPEDEDIKLNFFPDPPPFYKYFTTENLARLKDIEKEAAP | 68 1 | 80 47 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab