Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MPPILPPPDEQEYDQPLTIDGLPGRDLAAGNNLFFYFTSSPWFDPEDCINIAIFTNLNLQDPANAQTIMNDPKLWNQRIKETPKGIQYVIAGEGQGEGHPWLLQRQHKAEITKDDGSKEIGMFVEGNWYTHGTKVLMAPSLLDVVQSRLLTVATRMEQMAEISKNMTHWTPATGYSYFPPSHETSKAATTASRIGSPTLAPTDPDVAGSQSQGAGAGATSQTTDPLASTTEFSDALFMHSLNLTNAYGDEYMDENPLKGEPGAFVFEGTKTAVSARNKAQEQAAQASLSAPPAGLKIETQPPSVAPSAVGTPRGVATPTTAETQGKKGAIGAAPKKKKDRRKSQGGLTSPTTPSVP |
Length | 356 |
Position | Head |
Organism | Alternaria alternata (Alternaria rot fungus) (Torula alternata) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Alternaria> Alternaria sect. Alternaria> Alternaria alternata complex. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.528 |
Instability index | 46.17 |
Isoelectric point | 5.34 |
Molecular weight | 38051.12 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07569 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 77.60| 25| 56| 267| 291| 1 --------------------------------------------------------------------------- 267- 291 (40.00/24.56) EGTKTAVSA..RNKAQEQAAQASLSAP 324- 350 (37.60/22.70) QGKKGAIGAapKKKKDRRKSQGGLTSP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AGLKIETQ 2) TPTTAETQGKKGAIGAAPKKKKDRRKSQGGLTS | 293 317 | 300 349 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab