<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07566
| Description |
C/H/G cyclin |
| Sequence | MASSYWESTQKKFWTFTKPQLALERKRLEDSERNVVNMYPVPDRRHLSIYFYHQLSKMARPLGIRQQALATAQVYVRRFYVKVEIRRTNPALVLATALYLACKMEECPQHIRMVLAEARHCWDTSFNDISKIGECEFTLISEMNSQLIIHHPYRSLAELQSQFQLTQEENSLAWSIINDHYLTDLPLLHAPHVIAITAMFLAVVLKPTQGGLQVHAAGVASALQALGNARGGTGQGMQNRVQKLVDWLAESTVDIEAVVECTQELISLYEIWDSYAEKTCKDQIAKFVKARGLDK |
| Length | 295 |
| Position | Kinase |
| Organism | Paraphaeosphaeria sporulosa |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Massarineae> Didymosphaeriaceae>
Paraphaeosphaeria.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.180 |
| Instability index | 54.71 |
| Isoelectric point | 7.67 |
| Molecular weight | 33682.42 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07566
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.40| 20| 123| 122| 141| 2
---------------------------------------------------------------------------
122- 141 (38.10/28.14) W.DTSFNDISKIGECEFTLIS
247- 267 (31.29/21.99) WlAESTVDIEAVVECTQELIS
---------------------------------------------------------------------------
|