Description | Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MHELLLYGQLPPPRHEQVLKILAGHAAMQPRRVLERHIIYKPTREPEEPGAHLGRGGGSQTVGGKPVKQGTVKNLFYTKLVQKLDQGDFGRADDKPADSRKCLSANVNSGEEPKWSFEFQDLPDTGDRGVCARLTSSTDLLSGDPHAWMLATGPHQFVSEYYVEGHRFVHGNVVIFLHRILHEPGVRSLETAPKVDPPAFDALKPFDPSGAYILEAKVRVQDYNNQAVLEDGVNELKGFQKQMKGCVELDIPDRLSLDTRVRYRPPHLRVAQRPR |
Length | 275 |
Position | Head |
Organism | Paraphaeosphaeria sporulosa |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Massarineae> Didymosphaeriaceae> Paraphaeosphaeria. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.591 |
Instability index | 35.12 |
Isoelectric point | 8.36 |
Molecular weight | 30845.71 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07558 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 87.27| 25| 66| 181| 205| 1 --------------------------------------------------------------------------- 181- 205 (45.42/21.90) LHEPGVRSLETAPKVDPPAFD.ALKP 249- 274 (41.85/19.74) LDIPDRLSLDTRVRYRPPHLRvAQRP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) RHIIYK 2) VRYRPPHLRVAQRPR | 36 261 | 41 275 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab