<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07542
Description |
Uncharacterized protein |
Sequence | MELDQLFQNASGVENRHQDLHPFDMVILREAFKMRETTDADLSYVEKGTGRQMPEMCGNSTDKILENHKIRDKEKSKDHTCQHHRKDSANRKDDEKTRKSHRDINTNNLQKLQDKKRKFEGVDISSIQRGRKTELDNLKAKIVDTRIAR |
Length | 149 |
Position | Head |
Organism | Daucus carota subsp. sativus (Carrot) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Apiales> Apiaceae> Apioideae> Scandiceae> Daucinae>
Daucus> Daucus sect. Daucus.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -1.327 |
Instability index | 23.56 |
Isoelectric point | 9.23 |
Molecular weight | 17501.49 |
Publications | PubMed=27158781
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP07542
No repeats found
No repeats found
|