<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07539
Description |
Uncharacterized protein |
Sequence | MSGMMPSQSLLPRMQQYGLSSGSRSLASQNLSDQMFNLGATNPGSMMPLQQQQQQQQHVSQGTFGNMAANAQNMQPGIVPLQNTQQNHPNYQQQRQQNQ |
Length | 99 |
Position | Head |
Organism | Daucus carota subsp. sativus (Carrot) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Apiales> Apiaceae> Apioideae> Scandiceae> Daucinae>
Daucus> Daucus sect. Daucus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.998 |
Instability index | 70.72 |
Isoelectric point | 9.98 |
Molecular weight | 10991.10 |
Publications | PubMed=27158781
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP07539
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.87| 27| 40| 20| 57| 1
---------------------------------------------------------------------------
20- 57 (40.53/28.67) SSGS.RSLA..SQNLsdqmfnlgatNPGsMMPL..........QQQQQQQQ
60- 99 (35.34/10.47) SQGTfGNMAanAQNM..........QPG.IVPLqntqqnhpnyQQQRQQNQ
---------------------------------------------------------------------------
|