<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07531

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMLQNVPIQSPARLGLPNPNSPAPPKFSSSQIVQSHHSHQQSNTAGAVVTTTSPALLPLLPPLPRAQSLLVQMASLASRLFEVSPSRAHWLSAFRGSLPSFLSSQTQTLAPVPLDASPSSAKEIIALFTTLQTQLFEAVAELQEILDLQDAKQKIIREIRVKDSAVLGFANKLREAEQVLDELVDDYSDYRHLKRAKLDGGDDETYTTSVATRIKVNDILSYAHRISYTTFAPPEFGAGQVPLRGALPPAPQEEQMRASQLYAFADLDVGISKTVEDNETMIEPLIQSPATQPSESALANMATMQGMIPPNFVIPSGWKPGMPVELPIIPPPGWKPGDPVALPPFDSISGPSLVDEQPARPIIAPGISKAPEPIQVRHVQLDIEDDSDYTSDEASSDDDED
Length400
PositionMiddle
OrganismDaucus carota subsp. sativus (Carrot)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Apiales> Apiaceae> Apioideae> Scandiceae> Daucinae> Daucus> Daucus sect. Daucus.
Aromaticity0.06
Grand average of hydropathy-0.261
Instability index66.01
Isoelectric point4.67
Molecular weight43321.40
Publications
PubMed=27158781

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364141
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP07531
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.75|      22|      73|       9|      30|       1
---------------------------------------------------------------------------
    9-   30 (41.78/24.51)	SPARLGLPNPNSPAPPKFSSSQ
   83-  104 (40.97/23.88)	SPSRAHWLSAFRGSLPSFLSSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.71|      18|     182|     193|     210|       2
---------------------------------------------------------------------------
  193-  210 (30.91/21.58)	KRAKLDGGDDETYTTSVA
  376-  393 (31.81/22.40)	RHVQLDIEDDSDYTSDEA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.39|      24|      52|      58|      81|       3
---------------------------------------------------------------------------
   58-   81 (41.55/22.37)	LLP.PL...P.RAQSLLVQMASLASRLFE
  108-  136 (27.84/12.71)	LAPvPLdasPsSAKEIIALFTTLQTQLFE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      79.62|      17|      19|     314|     331|       4
---------------------------------------------------------------------------
  292-  309 (24.97/ 8.41)	PSeSALANMATMQG...MIPP
  314-  330 (37.86/18.63)	PS.GWKPGMPVELP...IIPP
  333-  349 (16.78/ 8.40)	....WKPGDPVALPpfdSISG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP07531 with Med4 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) IQSPARLGLPNPNSPAPPKFSSSQIVQSHHSHQQSNTAGA
2) VELPIIPPPGWKPGDPVALPPFDSISGPSLVDEQPARPIIAPGISKAP
7
323
46
370










Molecular Recognition Features






MoRF SequenceStartStop




1) ARPIIAPGISKAPEPIQVRHVQLDIEDD
358
385