<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07522
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MTSSLRDQVNDLLTEYTLVSQRYFQSLIQVAEDTPLDPQQSPEFYIQEMVKVDTQLQFALDQSKHEKITLPHPVLTFVNLLFTTLSLSLSLFTTLSLSLSLFTTLSLSLSLFPPVGEHQARQQQIIKVQDDIQDHQATLLSMVEQLNIANQDLEQTLNGAKKELQAADYAKKANIQFTDVLSYASKLSKYTSAPPNFDLMNRDIKVYFEKPYPDEERIRRGLLYWQHSSQPIPEDKFESSDNESMSDENSDTKKDEPASTEEDGPAPFWLLDLNP |
| Length | 275 |
| Position | Middle |
| Organism | Absidia glauca (Pin mould) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina>
Mucoromycetes> Mucorales> Cunninghamellaceae> Absidia.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.489 |
| Instability index | 48.06 |
| Isoelectric point | 4.53 |
| Molecular weight | 31412.82 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07522
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.85| 14| 15| 125| 139| 2
---------------------------------------------------------------------------
125- 139 (20.39/17.54) IIKvQDDI..QDHQATL
142- 157 (17.46/ 9.52) MVE.QLNIanQDLEQTL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.38| 16| 17| 200| 216| 3
---------------------------------------------------------------------------
200- 216 (24.89/17.56) MNRDIkVYFE...KPYPDEE
218- 236 (24.49/12.70) IRRGL.LYWQhssQPIPEDK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.50| 12| 19| 23| 36| 4
---------------------------------------------------------------------------
23- 36 (17.67/17.77) YFQSLIQVaeDTPL
45- 56 (21.83/14.23) YIQEMVKV..DTQL
---------------------------------------------------------------------------
|