Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MQRVTATEDLTSVEWRDTNWLERVGGFQNQQMVLDYFALSPFWDRHCNNQVLSMQTQYNDLRQPYEATVEALRKMTGIEFAVVHDQPPVWIIQKRYRRGPAPDDVNPIATYYIMGANVYQSPTIYSVIANRLLTSLFHVNSAFKETQSMMDFHPAKGYSWKTSADTSKKSASSSEKSPLTAKSASTNTASTSHTAKSNLRAQETQVFRHWMDRAIETASIKVTQARQIIDTPESEKMNATGAIDSPNSQLREIKKAHG |
Length | 258 |
Position | Head |
Organism | Mucor circinelloides f. lusitanicus CBS 277.49 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina> Mucoromycetes> Mucorales> Mucorineae> Mucoraceae> Mucor. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.620 |
Instability index | 36.28 |
Isoelectric point | 8.87 |
Molecular weight | 29257.50 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07515 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 56.83| 17| 18| 163| 179| 1 --------------------------------------------------------------------------- 163- 179 (28.19/18.13) SADTSKKSASSSEKSPL 183- 199 (28.64/18.53) SASTNTASTSHTAKSNL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) QLREIKKAHG 2) VWIIQKRYRR | 249 89 | 258 98 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab