<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07510
| Description |
Uncharacterized protein |
| Sequence | MSNSVADLELEYQRGSDTLMMHQYDIKSVKEENWFASYHDLFVSPCQRCHKLLQFDSPQYRYLPPMVRTWAKKQPIQQNEDAPMTQSTGVPYHMRCYIEYRNNHGM |
| Length | 106 |
| Position | Tail |
| Organism | Mucor circinelloides f. lusitanicus CBS 277.49 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina>
Mucoromycetes> Mucorales> Mucorineae> Mucoraceae> Mucor.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.847 |
| Instability index | 51.64 |
| Isoelectric point | 6.49 |
| Molecular weight | 12681.24 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP07510
No repeats found
No repeats found
|