| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSFHPQTPQSPSQASPATHPDFMTTAKSASAGPTTLPTPAHSVTGSISHQSDIAMADESPHKRKRPLDDIGERDQKKVQYDHRLGIEDLHLDVGPKYMLLQRTYEDQLPLLTGDLYEKFDLAELAAEVAREKPNGEKNALRKTYKGHIKRLGVAGQFDVQKKKEDAPSDFLAMMQVPDLEWSVHQVKGREIGDGLSEATTASLARAMTLSKGPIARSVWDTSVLGDMAPKNIGDASKPATAPAKPTAPNTPMATTPSAGAAVDRPRGPLAPGTDPLRPRRNIKKRTYGDSSYEGYGEGFPDDDGGADTGYSTGEGEGGQKRRKKSSGATPPYPPVRQHSYGPGMVGA |
| Length | 347 |
| Position | Head |
| Organism | Cordyceps confragosa RCEF 1005 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Cordycipitaceae> Akanthomyces> Cordyceps confragosa. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.798 |
| Instability index | 44.02 |
| Isoelectric point | 7.86 |
| Molecular weight | 37276.25 |
| Publications | PubMed=27071652 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP07500
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 135.13| 39| 52| 198| 245| 1
---------------------------------------------------------------------------
198- 236 (65.99/43.45) ATTASLARAMTLSKGPIARSVWDTSVLGDMAPKNIGDAS
253- 291 (69.14/30.34) ATTPSAGAAVDRPRGPLAPGTDPLRPRRNIKKRTYGDSS
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) QKRRKKSS 2) YPPVRQHSY | 319 332 | 326 340 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab