Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MSSPSAPPDWSEPQYGGYSRFEIELEFVQSLANPFYLNHLASQKLLTQPAFIAYLAYLQYWSRPPYLKYLTYPGPTLRHLELLQQERFRQDIMSPDLVQRLVEEGMRSAVQWHKEGAT |
Length | 118 |
Position | Middle |
Organism | Cordyceps confragosa RCEF 1005 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Cordycipitaceae> Akanthomyces> Cordyceps confragosa. |
Aromaticity | 0.14 |
Grand average of hydropathy | -0.478 |
Instability index | 80.49 |
Isoelectric point | 5.87 |
Molecular weight | 13824.53 |
Publications | PubMed=27071652 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:EnsemblFungi |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | DNA repair GO:0006281 IEA:EnsemblFungi meiotic gene conversion GO:0006311 IEA:EnsemblFungi meiotic sister chromatid segregation GO:0045144 IEA:EnsemblFungi regulation of transcription, DNA-templated GO:0006355 IEA:InterPro transcription by RNA polymerase II GO:0006366 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP07499 No repeats found |
MoRF Sequence | Start | Stop |
1) PYLKYLTYP 2) QYGGYSRFEI | 65 14 | 73 23 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab