<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07496
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MAGPNEPPLDEIQWRSPQILAGMGGLHSNTILFYFAESPFFERTSNNAVIMSQAMNNMAMYHFIQTREVFEGRLKTMSGLEFIVGEEPAETGPGMGTGVWVIRKQTRRKQQYQEDDEITVHASFFVVGENIYMAPTLADILASRIMTVSAALGKALPPAESIRTWRPSIGHVYQPPTNTSGSFSFAAGSRAKAAQESTEGTPLPDGSNKQQQQYQQAGSSRKNDEPELQRRAEEAFWIHMKYGGEYINENPITGRPGEFHLSSTGRKAVPLPKKGPESGMGAMNGPAVNSKTDSSKKDAKAPKTPKSATTPRIKRKKSKMSAANTPSMS |
| Length | 329 |
| Position | Head |
| Organism | Moelleriella libera RCEF 2490 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Clavicipitaceae> Moelleriella.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.643 |
| Instability index | 57.71 |
| Isoelectric point | 9.41 |
| Molecular weight | 36044.32 |
| Publications | PubMed=27071652
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07496
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.17| 16| 22| 218| 233| 1
---------------------------------------------------------------------------
218- 233 (27.34/13.10) GSSRKNDEPELQRRAE
243- 258 (29.83/14.78) GGEYINENPITGRPGE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 123.54| 39| 100| 69| 114| 2
---------------------------------------------------------------------------
69- 114 (58.70/36.64) VFEGRLKTMSGLEFIVG......EEPAETGPgMGTGvwvirkQTRRKQQYQE
172- 216 (64.84/27.25) VYQPPTNTSGSFSFAAGsrakaaQESTEGTP.LPDG......SNKQQQQYQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.06| 13| 20| 142| 154| 4
---------------------------------------------------------------------------
142- 154 (20.54/11.37) ASRIMTVSAALGK
159- 171 (24.51/14.71) AESIRTWRPSIGH
---------------------------------------------------------------------------
|