Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MAAESSDVHMTSSPPPAPPESSEPRYGGYSRFEIELEFVQSLANPLYLNHLAAQKLLTQPAFVAYLAYLQYWSRPPYLKYLTYPGPTLRHLELLQQERFRQDIMSPDLVQRLVEEGMRSAVQWHREGA |
Length | 128 |
Position | Middle |
Organism | Cordyceps fumosorosea ARSEF 2679 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Cordycipitaceae> Cordyceps. |
Aromaticity | 0.12 |
Grand average of hydropathy | -0.462 |
Instability index | 73.77 |
Isoelectric point | 5.77 |
Molecular weight | 14766.59 |
Publications | PubMed=27071652 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07493 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 52.81| 16| 22| 55| 70| 2 --------------------------------------------------------------------------- 55- 70 (27.97/16.87) KLLTQPA.FVAYLAYLQ 79- 95 (24.84/14.31) KYLTYPGpTLRHLELLQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PRYGGYSRFEI 2) YLKYLTY | 24 77 | 34 83 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab