<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07487
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MYEVFLTSTVEDADFTSACSVLEGLCSMKPWESVVRVLYYQGPPRPAGLSNQTSIEKPIRKNVAPLWRELHQNLGRQSFIVQARYEVLKNRDFGADAKPMELDATPGILRWTDFPDPSHGKPLLTQRKMVELWEQRALPSVLRDNQHQFKTEMVEEIYRFFRDEIEFSLTKQFFFHPIQEYTPLEARQGAMLSPAAQLPAWDSLTPMDMQGRWIMQVKTHVLQDNKPDDIRKAQDKLMALRTELEGVFDFRAIDRKVYDTRIALRQQGVQALPQKVMIGKS |
| Length | 281 |
| Position | Head |
| Organism | Cordyceps confragosa RCEF 1005 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Cordycipitaceae> Akanthomyces>
Cordyceps confragosa.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.484 |
| Instability index | 39.97 |
| Isoelectric point | 6.98 |
| Molecular weight | 32616.11 |
| Publications | PubMed=27071652
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07487
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.83| 14| 20| 87| 102| 1
---------------------------------------------------------------------------
87- 100 (25.43/15.34) VLKNRDF..GADAKPM
108- 123 (23.41/ 8.01) ILRWTDFpdPSHGKPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 83.88| 20| 21| 238| 257| 2
---------------------------------------------------------------------------
215- 233 (24.92/15.37) MQVKTHV..LQDNKPDDiRKA
238- 257 (34.80/24.17) MALRTELEGVFDFRAID.RKV
262- 276 (24.15/14.68) IALRQ..QGV...QALP.QKV
---------------------------------------------------------------------------
|