| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MAPIDNKVDHDVVEQQLKDIIQDLYQIMVQVSTYDSMGRPSKDVLSNEIKTLSRSLNTLHTTAAPPHVLPSVPPELLEYVENGRNPDIYTREFVELVRRGNQLMAGKMRGFGAFRDVLAHNVAAAMPELRDDVARVVEATSGGEMGATGIPPHVAAAVNGTAAAAANATQQTGRGGSSNDATGERAATATADGARTTAG |
| Length | 199 |
| Position | Middle |
| Organism | Cordyceps fumosorosea ARSEF 2679 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Cordycipitaceae> Cordyceps. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.308 |
| Instability index | 31.57 |
| Isoelectric point | 5.33 |
| Molecular weight | 21034.29 |
| Publications | PubMed=27071652 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP07483
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.33| 16| 18| 159| 174| 2
---------------------------------------------------------------------------
159- 174 (26.86/13.71) NGTAAAAANATQQTGR
180- 195 (26.47/13.42) DATGERAATATADGAR
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DATGERAATATADGARTTAG 2) VAAAVNGTAAAAANA | 180 154 | 199 168 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab