Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MAPIDNKVDHDVVEQQLKDIIQDLYQIMVQVSTYDSMGRPSKDVLSNEIKTLSRSLNTLHTTAAPPHVLPSVPPELLEYVENGRNPDIYTREFVELVRRGNQLMAGKMRGFGAFRDVLAHNVAAAMPELRDDVARVVEATSGGEMGATGIPPHVAAAVNGTAAAAANATQQTGRGGSSNDATGERAATATADGARTTAG |
Length | 199 |
Position | Middle |
Organism | Cordyceps fumosorosea ARSEF 2679 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Cordycipitaceae> Cordyceps. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.308 |
Instability index | 31.57 |
Isoelectric point | 5.33 |
Molecular weight | 21034.29 |
Publications | PubMed=27071652 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07483 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.33| 16| 18| 159| 174| 2 --------------------------------------------------------------------------- 159- 174 (26.86/13.71) NGTAAAAANATQQTGR 180- 195 (26.47/13.42) DATGERAATATADGAR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DATGERAATATADGARTTAG 2) VAAAVNGTAAAAANA | 180 154 | 199 168 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab