Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MDARHGHQPTLDPNTIQELEVLRAKLWSLQETFSTQITYLKEPKYPFTWPDLLNKFNMLTAKFASLSEDFYNFTETGSNATLLKLMLHPYTPTTTEQETNILSVLLRTKLIPDIEKLEAETQAAIAHDLKQPTSLQTDHNGSNNMDDDTLIRKGLVQWTTLRQRHDRLAVNAVNFVADFVHDHRDTFLQRYEDKDEDEDEEMEEKEWEKMGFSSEQVWRKWKLECMMNFYSSGKEEVQGSDLKKLSGVAKPN |
Length | 252 |
Position | Head |
Organism | Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina> Mucoromycetes> Mucorales> Phycomycetaceae> Phycomyces. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.755 |
Instability index | 37.15 |
Isoelectric point | 5.03 |
Molecular weight | 29375.62 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07462 No repeats found |
MoRF Sequence | Start | Stop |
1) GSDLKKLSGVAK 2) QVWRKWKLECMMNFYSS | 239 216 | 250 232 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab