<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07456
| Description |
Med9 RNA polymerase 2 transcription mediator |
| Sequence | MTEKKPVDSLSQLQDAVDQLAHQFLACLYFLDRHHSLEKLGPNDIVQEQKGDSGQPRALTVEPIPPDEFKQGQEELARDLVYKEQQIEYLIGSLPGLENTEQDQERLIRELEEELKVAEAQRKEAVRERDEMLAKLDHVIRGIKRP |
| Length | 146 |
| Position | Middle |
| Organism | Sporothrix insectorum RCEF 264 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Sporothrix.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.813 |
| Instability index | 44.78 |
| Isoelectric point | 4.85 |
| Molecular weight | 16866.81 |
| Publications | PubMed=27071652
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP07456
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.51| 11| 15| 84| 98| 1
---------------------------------------------------------------------------
84- 94 (19.38/20.82) EQQIEYLIGSL
101- 111 (19.13/ 6.71) EQDQERLIREL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.42| 19| 22| 38| 59| 2
---------------------------------------------------------------------------
38- 59 (27.90/21.58) EKLGPNDIvqeQKGDSGQPRAL
62- 80 (33.53/18.31) EPIPPDEF...KQGQEELARDL
---------------------------------------------------------------------------
|