<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07454
| Description |
Metacaspase |
| Sequence | MDPNPALPGEVTNLLDHEAKLVADAIQHFRAVALAATVRVSNRSTVGEAAANRLRMETEAAGLIKTAEDMLTLTRRIRELWVIGPLRKPGEGDAEAETRIRDAVVPVAGLLDGQRAQARQRLLGPHGTYRLTATGGPPPPAPPSTAAPATGAPSAPAPSAVTTAAATTGTATATAPTGPEGGVQPPLGSTTAAQTIAGGAEAGPGVAATAGGGTNTGTNATATAQLNQT |
| Length | 229 |
| Position | Head |
| Organism | Sporothrix insectorum RCEF 264 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Sporothrix.
|
| Aromaticity | 0.01 |
| Grand average of hydropathy | -0.178 |
| Instability index | 29.14 |
| Isoelectric point | 6.31 |
| Molecular weight | 22776.23 |
| Publications | PubMed=27071652
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07454
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.90| 18| 44| 47| 64| 3
---------------------------------------------------------------------------
47- 64 (30.45/17.34) GEA.AANRLR.METEAAGLI
92- 111 (21.45/10.21) GDAeAETRIRdAVVPVAGLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.94| 16| 16| 186| 201| 4
---------------------------------------------------------------------------
186- 201 (27.69/10.49) PLGSTTAAQTIAGGAE
204- 219 (26.24/ 9.54) PGVAATAGGGTNTGTN
---------------------------------------------------------------------------
|